PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03971.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 296aa    MW: 33056.6 Da    PI: 5.4701
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03971.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.41.2e-112331648
                                    HHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding 16 vkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                    v++lG++ W+tIa+ ++ gR +kqc++rw+++l
  Zmw_sc03971.1.g00030.1.es.mkhc  2 VNKLGPKKWSTIAQALP-GRIGKQCRERWHNHL 33
                                    99***************.*************97 PP

2Myb_DNA-binding53.17.5e-173981145
                                    TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
                 Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                                    + +WT+eE+ +l++a++ +G++ W+  ++ ++ gRt++ +k++w+
  Zmw_sc03971.1.g00030.1.es.mkhc 39 KEAWTQEEEIRLIHAHQTYGNK-WAELSKFLP-GRTDNAIKNHWH 81
                                    579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001675.08E-9133No hitNo description
SMARTSM007170.34135IPR001005SANT/Myb domain
PROSITE profilePS5129416.75133IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-19240IPR009057Homeodomain-like
PfamPF002491.3E-9233IPR001005SANT/Myb domain
SuperFamilySSF466891.68E-291390IPR009057Homeodomain-like
PROSITE profilePS5129425.1153488IPR017930Myb domain
SMARTSM007174.5E-153886IPR001005SANT/Myb domain
PfamPF002495.0E-153981IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-224188IPR009057Homeodomain-like
CDDcd001671.34E-124181No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MVNKLGPKKW STIAQALPGR IGKQCRERWH NHLNPGINKE AWTQEEEIRL IHAHQTYGNK  60
WAELSKFLPG RTDNAIKNHW HSSVKKKIDS YRASGLLAQF QGIMHVEYPA VSLNIDSSSA  120
MTQQHSEDSG FNVGGVEGST ELSQSSLAKA SCSQEEQIEP SLDSHVHAHN SLCQEPCYNN  180
ADNVASVLPE MQHIADSDED THLQKFSQTT ELPFDIDKEP KNSMSTDMQT SSELAGQLQY  240
TQTMYNSENH GGSFNPYAVD PDVPISMSHN IPKYGHNVDV MCEVGISCDK YLESEL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A8e-3818818105MYB PROTO-ONCOGENE PROTEIN
1mse_C8e-3818818105C-Myb DNA-Binding Domain
1msf_C8e-3818818105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960645.11e-128PREDICTED: myb-related protein 3R-1
RefseqXP_004960646.11e-128PREDICTED: myb-related protein 3R-1
RefseqXP_004960647.11e-128PREDICTED: myb-related protein 3R-1
SwissprotQ9S7G73e-54MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLK3Z3V01e-107K3Z3V0_SETIT; Uncharacterized protein
STRINGSi021218m1e-106(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879